Find your PDFs fast.
Welcome to the Pubget Medical Subject Headings (MESH) browser. Click on a topic or subtopic below to explore related papers. In the gold box is the most recent paper about the current MESH term, and below are 20 related papers.
Cysteine (5):
Recent article
Cysteine
Journal of Proteomics (74)8 2011
Abstract
In common with other aerobic organisms, plants are exposed to reactive oxygen species resulting in formation of post-translational modifications related to protein oxidoreduction (redox PTMs) that may inflict oxidative protein damage. Accumulating evidence also underscores the import...
|
PMID: 21406256
PDF is available here.
PDF is available here.
| < More recent | Older article > |
Xenobiotica (41)5 2011
Abstract
We describe here our experience with site-specific protein modification via a novel cysteine-containing fusion tag (Cys-tag), which is a 15-amino-acid (aa) N-terminal fragment of human ribonuclease I with the R4C substitution. Several Cys-tagged proteins and peptides with different numbers of native...
|
PMID: 18726580
PDF is available here.
PDF is available here.
Analytical Biochemistry (411)1 2011
Abstract
We probed active cysteine cathepsins in blood. Incubation of the probe in human whole blood followed by separation of white blood cells by dextran sedimentation led to the labeling of one major band at 24kDa. Two-dimensional gel electrophoresis showed that the band resolved in a single protein spot...
|
PMID: 21094118
PDF is available here.
PDF is available here.
Abstract
To investigate the role of cysteinyl leukotriene (CysLT) receptors in the differentiation of rat glioma C6 cells.
|
PMID: 21488208
PDF is available here.
PDF is available here.
Abstract
These results support hypotheses as to why certain Cu(i) binding amino acids are preferred over others in proteins expressed at different pH and exposed to oxidative environments. The results also have implications for interpreting site-directed mutagenesis studies aimed at identifying copper bindin...
|
PMID: 21553704
PDF is available here.
PDF is available here.
Abstract
We have accomplished thermodynamic analysis of mouse TREK-1 gating and functional testing of several deletion mutants. The predicted increase of the channel in-plane area (ΔA) of ~5 nm(2) in models was supported by the experimental ΔA of ~4 nm(2) derived from the slope of open probability versus m...
|
PMID: 21057213
PDF is available here.
PDF is available here.
Abstract
Botulinum type A toxin (BoNT/A) is defined by its specific endopeptidase cleavage of SNAP25 between Gln(197) and Arg(198) under reducing conditions. The neurotoxin is widely used for therapeutic or cosmetic purposes, but should not contain other toxin serotypes or unwanted protease activities. Using...
|
PMID: 20832960
PDF is available here.
PDF is available here.
Abstract
We investigated the role of active site residues in the peroxidase activity of Orp1 (GPx3) using three different peroxide substrates. Using a structural homology model of the reduced form of Orp1, we identified Asn126 and Phe127 as evolutionarily conserved residues that line the back of the Orp1 act...
|
PMID: 21036150
PDF is available here.
PDF is available here.
Abstract
We compared the SPECT images between the groups.
Significant hyperperfusion was found at the left superior temporal gyrus and the left supramarginal gyrus in the panic disorder patients when compared to the controls (family-wise error [FWE], P < .001). The somatoform disorder patients showed hyperpe...
|
PMID: 20673555
PDF is available here.
PDF is available here.
Cryobiology (61)3 2010
Abstract
The aim of this study was to determine the effects of antioxidants such as reduced glutathione (GSH) and cysteine in Laiciphose® extender on semen parameters, fertilizing ability, lipid peroxidation (LPO) level and glutathione peroxidise (GPx) activity of post-thawed bull semen. Tot...
|
PMID: 20951122
PDF is available here.
PDF is available here.
Abstract
This study proposed a stress testing to study oxidative stability and estimate the potential shelf-life of l,l-ethylenedicysteine (l,l-EC) under normal storage temperature condition (20-25 degrees C). l,l-EC was detected as a function of time at four different temperatures by ultra-performance liqui...
|
PMID: 20673634
PDF is available here.
PDF is available here.
Abstract
We show that 2-Cys Prxs from several prokaryotic organisms, including cyanobacteria, contain the GG(L/V/I)G and YF motifs characteristic of sensitive enzymes. In search of the existence of overoxidation-sensitive 2-Cys Prxs in prokaryotes, we have analyzed the sensitivity to overoxidation of 2-Cys P...
|
PMID: 20736168
PDF is available here.
PDF is available here.
Abstract
We employed Cys-scanning analysis of the xanthine-specific homolog YgfO from Escherichia coli. Using a functional mutant devoid of Cys residues (C-less), each amino acid residue in sequences (259)FLVVGTIYLLSVLEAVGDITATAMVSRRPIQGEEYQSRLKGGVLADGLVSVIASAV(314) and (342)TIAVMLVILGLFP(354) including thes...
|
PMID: 20802252
PDF is available here.
PDF is available here.
Abstract
It is proposed that the glycine precursor NH(2)CH(2)CN may be synthesised in interstellar dust clouds by the radical combination reactions NH(2)˙ + ˙CH(2)CN → NH(2)CH(2)CN (ΔG = -302 kJ mol(-1)) and/or NH(2)CH(2)˙ + ˙CN → NH(2)CH(2)CN (ΔG = -414 kJ mol(-1)). All calculations at the CCSD(T)...
|
PMID: 20820658
PDF is available here.
PDF is available here.
Abstract
Absolute bond dissociation energies of water to sodium cysteine (Cys) cations and cysteine to hydrated sodium cations are determined experimentally by collision-induced dissociation of Na(+)Cys(H(2)O)(x), where x = 1-4, complexes with xenon in a guided ion beam mass spectrometer. Experimental result...
|
PMID: 20607166
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)45 2010
Abstract
We investigated the regulatory mechanism of Srx induction by lipopolysaccharide (LPS) in mouse macrophages. LPS up-regulated Srx expression on the transcriptional level. The promoter region of the Srx gene contained putative NF-κB and AP-1 (activator protein-1) sites, and the proximal site of three...
|
PMID: 20826812
PDF is available here.
PDF is available here.
Current protocols in protein science / editorial board, John E. Coligan ... [et al.] (Chapter 14) 2010
Abstract
I (GGTase I), and Rab geranylgeranyl transferase (also termed geranylgeranyltransferase type II - GGTase II). In this unit, synthetic isoprenoids conjugated to either a fluorophore or biotin group are used to assay the activity of protein prenyltransferases in vitro or to affinity tag prenylatable p...
|
PMID: 21104984
PDF is available here.
PDF is available here.
Chemical Communications (46)40 2010
Abstract
M. tuberculosis PtpA and PtpB, the only two phosphotyrosine phosphatases (Ptps) present in this pathogen, play an important role in mycobacteria survival inside macrophages. The aim of the present work was to investigate M. tuberculosis PtpA and PtpB susceptibility to S-nitrosylation, a reversible c...
|
PMID: 20830431
PDF is available here.
PDF is available here.
Abstract
We report the X-ray structure of the MATE transporter NorM from Vibrio cholerae determined to 3.65 Å, revealing an outward-facing conformation with two portals open to the outer leaflet of the membrane and a unique topology of the predicted 12 transmembrane helices distinct from any other known M...
|
PMID: 20861838
PDF is available here.
PDF is available here.
YAKUGAKU ZASSHI (130)10 2010
Abstract
We have employed a combination of cysteine mutagenesis and chemical crosslinking using a photoactivatable sulfhydryl reagent, benzophenone-4-maleimide, to obtain a covalent complex between human galectin-1 and a model glycoprotein ligand, asialofetuin. We previously obtained a crosslinked product wh...
|
PMID: 20930491
PDF is available here.
PDF is available here.
Kidney International (67) 2010
Abstract
Kidney International (78)10 2010
Abstract
Abstract
We tested the hypothesis by replacing these cysteines with alanines and showed that depletions of one or both of the cysteine pairs do not hamper the function of CLV2 in SAM maintenance. In vitro peptide assay also showed that removal of the cysteine pairs did not affect the perception of CLV3 pepti...
|
PMID: 20738721
PDF is available here.
PDF is available here.
Abstract
Chromium and cysteine supplementation can improve glucose metabolism in animal studies. This study examined the hypothesis that a cysteinate complex of chromium is significantly beneficial than either of them in lowering blood glucose and vascular inflammation markers in Zucker diabe...
|
PMID: 20306473
PDF is available here.
PDF is available here.
Abstract
We then compared these values with the results of T1, T2, and fluid-attenuated inversion recovery in magnetic resonance imaging (MRI).
A total of 16 patients with proved MS were enrolled in the study, and the MRI with and without gadolinium contrast and also brain SPECT with Tc-99m MIBI (8 cases) or...
|
PMID: 20706041
PDF is available here.
PDF is available here.
Atherosclerosis (212)1 2010
Abstract
Genetic and dietary hyperhomocysteinemia has been found to decrease high density lipoproteins (HDL) and their apolipoprotein A1 (APOA1). To test the hypothesis that the presence of cysteine could normalize HDL levels in hyperhomocysteinemic cystathionine beta-synthase (Cbs)-deficient mice and that t...
|
PMID: 20537649
PDF is available here.
PDF is available here.
Chemical Communications (46)31 2010
Abstract
A new fluorogenic fluorescein derivative containing an alpha,beta-unsaturated aldehyde moiety produces a selective fluorescent signal enhancement in the presence of cysteine or peptides containing N-terminal cysteine residues. The mechanism is based on synergistic covalent and supramolecular interac...
|
PMID: 20617237
PDF is available here.
PDF is available here.
Abstract
Abstract
We developed polylysine based DNA nanoparticles (DNA NPs) that contain disulfide linkage in the carrier and demonstrated that this reducible DNA NP enhances in vitro gene transfer via an extracellular mechanism. Polylysine was conjugated through an N-terminal cysteine to a polyethylene glycol chain...
|
PMID: 20438780
PDF is available here.
PDF is available here.
Abstract
We have recently shown significant preventive benefit of methylseleninic acid (MSeA) and Se-methylselenocysteine (MSeC) in the transgenic adenocarcinoma mouse prostate (TRAMP) model by oral administration. The present work applied iTRAQ proteomic approach to profile protein changes of the TRAMP pros...
|
PMID: 20647336
PDF is available here.
PDF is available here.
Abstract
We report six new three-finger like toxins isolated from the venom of the coral snake M. frontalis which we named Frontoxin (FTx) I-VI. Toxins were purified using multiple steps of RP-HPLC. Molecular masses were determined by MALDI-TOF and ESI ion-trap mass spectrometry. The complete amino acid sequ...
|
PMID: 20331995
PDF is available here.
PDF is available here.
Abstract
We have developed amber, opal, and ochre suppressor tRNAs derived from Escherichia coli, and yeast tRNA(Cys) that incorporate a chemically modified cysteine residue with high selectivity at the cognate UAG, UGA, and UAA stop codons in an in vitro translation system. These synthetic tRNAs were aminoa...
|
PMID: 20581130
PDF is available here.
PDF is available here.
Abstract
We reported that Bet3 has a unique self-palmitoylating activity. Here we show that mutation of arginine 67 reduced self-palmitoylation of Bet3, but the effect was compensated by increasing the pH. Thus, arginine helps to deprotonate cysteine such that it could function as a nucleophile in the acylat...
|
PMID: 20372964
PDF is available here.
PDF is available here.
Abstract
We present the results of molecular dynamics simulations combined with pKa calculations on the monomeric, dimeric and decameric forms of one typical 2-Cys Prx, the tryparedoxin peroxidase from Trypanosoma cruzi (PDB id, 1uul). The calculations indicate that C(p) (C52) pK(a) values are highly affecte...
|
PMID: 20476795
PDF is available here.
PDF is available here.
Abstract
We examined four cell lines for their sensitivity to MSC and SeMet in comparison with selenite. SeMet increased apoptotic cells in p53-positive A549 cells, whereas MSC increased apoptotic cells in p53-mutated HSC-3 cells. High activities of caspase-3, -8 and -9 were observed during apoptosis, and a...
|
PMID: 19940991
PDF is available here.
PDF is available here.
Abstract
These results suggest that our method will be useful in obtaining a large quantity of mPEG(10K)-cGLP-1 for further study and mPEG(10K)-cGLP-1 might find a role in the therapy of type 2 diabetes through C-terminal site-specific PEGylation....
|
PMID: 19728172
PDF is available here.
PDF is available here.
Journal of Biochemistry (148)2 2010
Abstract
We also demonstrated that the C145S mutation didn't affect the autologous hexamerization of this protein, and the mutant had increased bioactivities including phosphate transferase and DNase. These findings support the hypothesis that the formation of DBs in NDPK-A is involved in the regulation of t...
|
PMID: 20403806
PDF is available here.
PDF is available here.
Circulation Research (107)2 2010
Abstract
In Galphaq-induced cardiomyopathy, myocyte contractile dysfunction is mediated, at least in part, by 1 or more oxidative posttranslational modifications of SERCA. Protein oxidative posttranslational modifications contribute to the pathophysiology of myocardial dysfunction and thus may provide a targ...
|
PMID: 20508180
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)29 2010
Abstract
We show here that forced expression of xCT, the substrate-specific subunit of the cystine/glutamate antiporter, in gamma-glutamylcysteine synthetase knock-out cells rescues GSH deficiency by increasing cellular cystine uptake, leading to augmented intracellular and surprisingly high extracellular cy...
|
PMID: 20463017
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)29 2010
Abstract
We show that substrates of the nuclear export receptor CRM1 accumulate in the nucleus in the presence of 15d-PGJ(2), identifying this prostaglandin as a regulator of CRM1-dependent nuclear protein export that can be produced endogenously. Like leptomycin B (LMB), an established fungal CRM1-inhibitor...
|
PMID: 20457605
PDF is available here.
PDF is available here.
Abstract
We identify the mechanistic principles by which movements on the inner bundle gate trigger conformational changes at the selectivity filter, leading to the non-conductive C-type inactivated state. Analysis of a series of KcsA open structures suggests that, as a consequence of the hinge-bending and r...
|
PMID: 20613845
PDF is available here.
PDF is available here.
Abstract
Chromium(III) is an essential trace element required for normal protein, fat and carbohydrate metabolism. It also helps in energy production and increasing lean body mass. Chromium(III) dinicocysteinate (CDNC) is a unique form of bioavailable chromium(III). This study was focused on...
|
PMID: 20515439
PDF is available here.
PDF is available here.
Biological Chemistry (391)7 2010
Abstract
We show that deletion of the rhdA gene generates an oxidative stress condition to which A. vinelandii responds by activating defensive mechanisms. In conditions of growth in the presence of the superoxide generator phenazine methosulfate, a stressor-dependent induction of rhdA gene expression was ob...
|
PMID: 20482308
PDF is available here.
PDF is available here.
Hepatology (52)1 2010
Abstract
Hepatology (52)1 2010
Abstract
Hepatology (52)1 2010
Abstract
Hepatology (52)1 2010
Abstract
Hepatology (52)1 2010
Abstract
Abstract
Reading epilepsy is a rare form of epilepsy, classified among idiopathic, age- and localisation-related (partial) epilepsies as a reflex epilepsy syndrome. Seizures usually consist of myoclonic jerks restricted to the jaw. However, distinct ictal features including visual symptoms an...
|
PMID: 19620139
PDF is available here.
PDF is available here.
Abstract
We examined two such mutations, A40V and G45E, which are positioned near the TM1/E1 boundary and are associated with keratitis ichthyosis deafness (KID) syndrome. Both of these mutants have been reported to form hemichannels that open aberrantly, leading to "leaky" cell membranes. Here, we quantifie...
|
PMID: 20584891
PDF is available here.
PDF is available here.
FEBS Letters (584)13 2010
Abstract
We show that Sep-tRNA(Sec) is a substrate for SepCysS. Since Sec and Cys are the only active site amino acids known to sustain FDH activity, we conclude that SepCysS converts Sep-tRNA(Sec) to Cys-tRNA(Sec), and that Sep is crucial for SepCysS recognition.
Copyright 2010 Federation of European Bioche...
|
PMID: 20493852
PDF is available here.
PDF is available here.
Biophysical Journal (99)1 2010
Abstract
We determine the role these cysteine residues play in the voltage sensing capabilities of prestin. Mutations of any single cysteine residue had little or no effect on charge movement. However, using combinatorial substitution mutants, we identified a cysteine residue pair (C415 and either C192 or C1...
|
PMID: 20655836
PDF is available here.
PDF is available here.
Anesthesiology (113)1 2010
Abstract
L-cysteine adduction occurs at different rates by design in olefinic isoquinolinium diester neuromuscular blockers, yielding corresponding durations of action. Antagonism by exogenous L-cysteine is superior to anticholinesterases, inducing inactivation of the active molecules to restore function rap...
|
PMID: 20526187
PDF is available here.
PDF is available here.
Biochimica et Biophysica Acta (1804)7 2010
Abstract
We replaced Cys108 individually by a serine (C108S) and an aspartate (C108D), and characterized the purified variants with regard to their biochemical and kinetic properties, thermostability, and reactivity towards oxidation by hypochlorite. Tandem MS analysis of tryptic peptides derived from a hypo...
|
PMID: 20193780
PDF is available here.
PDF is available here.
Biochimica et Biophysica Acta (1804)7 2010
Abstract
We identified oxidative modification of the 10th cysteine of TTR through S-sulfonation in vitro. Based on mass spectrometric analysis, we determined the spectrophotometric, western blotting, and fluorescent microscopic properties of TTR incubated with and without cysteine-S-sulfonate in acidic (pH 4...
|
PMID: 20388560
PDF is available here.
PDF is available here.
Abstract
We explore the idea that these dysautonomias results, in part, from a defect in synaptic transmission. To test this idea, we investigated cultured sympathetic neurons and show that hyperglycemia inactivates nAChRs through a mechanism involving an elevation in reactive oxygen species and an interacti...
|
PMID: 20620869
PDF is available here.
PDF is available here.
Zhonghua Yixue Zazhi (90)24 2010
Abstract
We also set up two control groups: LPS and saline.
The rHDL52 mice had a significant decrease of plasma TNF-alpha and IL-1beta and the protection of lung against acute injury. 24 h post-injection as compared with rHDLwt group [TNF-alpha: (135.28 +/- 12.84) pg/ml, IL-1beta: (82.00 +/- 8.19) pg/ml], t...
|
PMID: 20979886
PDF is available here.
PDF is available here.
Abstract
Excess reactive oxygen species (ROS) play a crucial role under pathophysiological conditions, such as ischaemia/reperfusion and diabetes, potentially contributing to cardiac arrhythmia. hERG1 (KCNH2) potassium channels terminate the cardiac action potential and malfunction can lead to long-QT syndrom...
|
PMID: 20547678
PDF is available here.
PDF is available here.
Abstract
We show here that a diverse set of NOD anti-insulin T cells all recognize this peptide bound in the same register. Surprisingly, this register results in the poorest binding of peptide to IA(g7). The poor binding is due to an incompatibility between the p9 amino acid of the peptide and the unique IA...
|
PMID: 20534455
PDF is available here.
PDF is available here.
Abstract
We demonstrate that introduction of TCRs resulted in formation of neoreactive mixed TCR dimers, composed of the introduced TCR chains pairing with either the endogenous TCR alpha or beta chain. Neoreactivities observed were HLA class I or class II restricted. Most neoreactive mixed TCR dimers were a...
|
PMID: 20534461
PDF is available here.
PDF is available here.